NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180120_10181043

Scaffold Ga0180120_10181043


Overview

Basic Information
Taxon OID3300017697 Open in IMG/M
Scaffold IDGa0180120_10181043 Open in IMG/M
Source Dataset NameFreshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)881
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)37.1043Long. (o)-76.1811Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003051Metagenome / Metatranscriptome510Y
F011192Metagenome / Metatranscriptome294Y
F059345Metagenome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0180120_101810431F003051N/AMKTKILKSKVVIDMSVSEYDTLFKYIGKLESMLNTLHETNDLWLSDVHNLSSLKWELIEMLDAEWNPDTYRYVKRGAKX
Ga0180120_101810433F011192GGAGGMTAKEMTDDNFINFQDDFYNLLEKYGVSSIDIEHPHFATICNLRDSVVEFIEQETWEEDD
Ga0180120_101810435F059345GGAGGMTDLEKLESIHCALQELQQEFNISNDHEHLENAFKFTEDLREKYLKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.