NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181364_1003682

Scaffold Ga0181364_1003682


Overview

Basic Information
Taxon OID3300017701 Open in IMG/M
Scaffold IDGa0181364_1003682 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2715
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009265Metagenome / Metatranscriptome320Y
F009526Metagenome / Metatranscriptome316N
F029096Metagenome189Y

Sequences

Protein IDFamilyRBSSequence
Ga0181364_10036823F029096N/AMGMAEGRTTITVRPDLQDYRGLLKALNLMEKESQLQLKDDVYAISAWTAKGIQQAGYAHPFYPNQARIVAQSVKPSRDRVPTVRVGGSKGRVSGGANAGQLLWGNEFGGDRNALGNLNAFANGGYRFPPRTSREGRGNTGYWIFPTLKAMQPEIKKRWFAAVNKVMDNWARTS
Ga0181364_10036824F009265AGGMQYTIKTKQGNNYIVSDDSTWLWIEIERDLGYTVTQAAEKMSQGSLDVITCMLYKASKAAGHTKMPSQQAWVTNEFDGFEVVEESPKEN
Ga0181364_10036825F009526N/ARHAYQPTLNRAGHNQLERQVMPATYITGRNLTLSINSVSYADQASTVTLELENNQQVLEVLSGRAYKTVDRTATLNVELYLDDTSSAGIISALWDAAKASPDTPLAFSFDVNGDTFTGNLFPVFPTVGGAATDVLTTSLSFVVEDGSVTRA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.