NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181369_1005360

Scaffold Ga0181369_1005360


Overview

Basic Information
Taxon OID3300017708 Open in IMG/M
Scaffold IDGa0181369_1005360 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3415
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameSubarctic Pacific Ocean
CoordinatesLat. (o)-20.099Long. (o)-70.892Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001588Metagenome / Metatranscriptome667Y
F053969Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0181369_10053602F053969AGGAGMQNKNTLTQVEKAFLVQFLANTFAGLTDNNAESLLEALEPAEADYYAESAFVRLQDAQEVQEHLNILYSTAEQEPARFTFTIQQAAAAICSYDTEYRECIVEQLEYACTEDLQRFYPAFANANCKQTNFATLPARMYDNY
Ga0181369_10053603F001588AGGAGMQNTQTHNYVFLAAEAACIVVKVNNVTVATDVQTADALIEVFLQHNINCVTDTIMCSSSIDFAAEENFATDACAHNIIDAALDVLAPVQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.