NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181403_1015321

Scaffold Ga0181403_1015321


Overview

Basic Information
Taxon OID3300017710 Open in IMG/M
Scaffold IDGa0181403_1015321 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1639
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002593Metagenome / Metatranscriptome545Y
F010275Metagenome / Metatranscriptome306Y
F037471Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0181403_10153211F002593N/ASKNGSQTTESIRNASPMIQAVWNQANKFGANIVRVRAYQDRFGNDTGKTFNSYHHEKVSVYKQKDEVHESNALYFAQKIPVTKSNKGMQILEVASNLDVQDTLDIIDEIQYYAETSFLGRLWNRIRYGTPMSITS
Ga0181403_10153212F037471GGAGMAQMRVKDQDLVVEQVVSKIEAEKLNEFKAREDVQAVQSDVEARIEVISRLVEQYRELEETIKAEQKELKDLVQAFQKSNGFEYSSYATQQGIWLDNLSTYGVSIPELKIVWQLPYTTKHEMTTKLRLQTMGGDFDVYKLIEDLTAEFSS
Ga0181403_10153213F010275AGGAGMSNEVNDTIIENLRDNVHELWVLDSRPDLEADCLQYCYENIHTPVPYAMIEFLSQHCSQAVSTQDLEHMAKGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.