NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181412_1018257

Scaffold Ga0181412_1018257


Overview

Basic Information
Taxon OID3300017714 Open in IMG/M
Scaffold IDGa0181412_1018257 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1997
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002495Metagenome / Metatranscriptome554Y
F005537Metagenome / Metatranscriptome397Y
F008307Metagenome / Metatranscriptome335Y

Sequences

Protein IDFamilyRBSSequence
Ga0181412_10182574F008307AGCAGMVKVLKTSSLELAANFEEIFDGATVEEATKKAHNQKMPSESAKVNITDNRFISANVKIVGEEHDNESEQYDKIVPKAEXST
Ga0181412_10182576F005537AGGMSDNVKFISEIERLLKQKQNDYGHFDHTSYVIVGVMEKYLSIHNNQDVKIPLKFFGLFMIFLKCWRIMQSENYKKDSFDDINGYTELLRRLVIDENKTKR
Ga0181412_10182578F002495N/ADWVLFPYDANNEKAIKIDFSGNVNLDNGNKGTILGVKGSSRDGNTKFVKVFAQVGVLFKGDDKFTGDMNYPEAGGAKGLIGWINESGNILSGYKNDPRPKQAKPQSKEIPF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.