Scaffold Ga0181398_1000809

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0181398_1000809

Scaffold Ga0181398_1000809

Overview

Basic Information
Taxon OID	3300017725 Open in IMG/M
Scaffold ID	Ga0181398_1000809 Open in IMG/M
Source Dataset Name	Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9315
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (58.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	33.55	Long. (^o)	-118.4	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044161	Metagenome / Metatranscriptome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181398_10008099	F044161	GAG	MSKFKNMYKEFFGLKEQTNSKIPNPKEIEDATNAIKDLGDAMKDAGLAESELEEAQLVNNLSDYNGHVIYQLRDPQEANAVAKDIQRWTTKKGFTIISHEKSKSGRTGYFYFRLGEDPGTESQKIQGYFAQLPELLKFAFKAPKSKESKKMKQRKF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.