NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181365_1127965

Scaffold Ga0181365_1127965


Overview

Basic Information
Taxon OID3300017736 Open in IMG/M
Scaffold IDGa0181365_1127965 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)607
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)108
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009461Metagenome / Metatranscriptome317Y
F021981Metagenome / Metatranscriptome216N
F091626Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0181365_11279651F009461N/AVMWFMIATGLLAYALNLWQTETYNRGYWRGRATGWDMHRRMINIKRQSDEVFDYDKN
Ga0181365_11279652F021981N/AMPTTTEKLFNNATAIVHERGVVYGHAIYNMDRIAKSVSSYIDYPLSAHDIPIINILQKISRLAESPGHEDSIVDICAYMAIYKMCIEAEKDDQFEWRVGE
Ga0181365_11279653F091626N/AMESWRVMAFNMNDYEDVTTLNKWFIGNYPMGRSDISVVSHDPVNSYILV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.