NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181402_1007028

Scaffold Ga0181402_1007028


Overview

Basic Information
Taxon OID3300017743 Open in IMG/M
Scaffold IDGa0181402_1007028 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3519
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (46.15%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018831Metagenome / Metatranscriptome233Y
F018932Metagenome / Metatranscriptome232Y
F031501Metagenome / Metatranscriptome182N

Sequences

Protein IDFamilyRBSSequence
Ga0181402_10070281F031501N/AMTANTTMMTMTTELLDLFEEAKRIIDKQEELINRQQSIIKTMQQALQGVELNELLLKKQIADIQEELLTITNDYIDSKSIREGGV
Ga0181402_10070285F018831AGAAGMKIVASVSIEINVEDTELLDDAKERAIDALIDNLEDWLNNNGIPPIISIEYKLPEYDDNDIEFLN
Ga0181402_10070286F018932N/ALTKDRATRHQEIWKRTKNGLELVMPKKITSDIGFQLMFGHREDHRVEEKRIEDNANKYDCKTYLNVEDFKKYI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.