NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181407_1013574

Scaffold Ga0181407_1013574


Overview

Basic Information
Taxon OID3300017753 Open in IMG/M
Scaffold IDGa0181407_1013574 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2305
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001611Metagenome / Metatranscriptome663N
F002374Metagenome / Metatranscriptome566Y
F007722Metagenome / Metatranscriptome346Y
F013311Metagenome / Metatranscriptome272Y

Sequences

Protein IDFamilyRBSSequence
Ga0181407_10135741F007722N/ALTGDIGTIKKSIQTLNNRINGLNSPKLNDELLQYAIKQQSNVHDINKKHIGG
Ga0181407_10135742F013311AGGAGGLAFLGDFGKFFNLGSSKEVLGDAGRAVGTYLGGPSGGEIGANIGRTVARATDNLAGDSDISPLSTADQALEQSAVPVSTINSPRPSETSNIGLTGTTQQAGFGSLIPGVIGAARSAFPQIGKFVSTPGGAIATGVGTSVGVNMFQGQQKFGTRTVLTQSRRNKARVRQLVNFMGIEGAAQFLSQAMNTNVMPSDVVNLLLRTFRNDGAYITKAQVRNLRRTTNRFKSLEKQVKEATSMTRTTRRPAMRRASSTTLIKN
Ga0181407_10135743F001611AGGAGGMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDVAGTSETADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGSYVNNDLLTTGSQRNRVLVRFTNDTAAQKTIRCGVFIG
Ga0181407_10135745F002374N/AMNQVLLYVSVFLASVSFFLCCYACARVGKLLNSVKGLDWDTIASLTGDIGTIKKSIQTLNNRINGLNSPKLNDELLQYAIKQQS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.