Scaffold Ga0181344_1007003

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0181344_1007003

Scaffold Ga0181344_1007003

Overview

Basic Information
Taxon OID	3300017754 Open in IMG/M
Scaffold ID	Ga0181344_1007003 Open in IMG/M
Source Dataset Name	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3728
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (91.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location Name	USA: Michigan
Coordinates	Lat. (^o)	43.2382	Long. (^o)	-86.2805	Alt. (m)		Depth (m)	8
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006062	Metagenome	382	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181344_10070039	F006062	GAGG	VKRIFPKGTTPEQLAVAATRMVQGLSPDRAWCIEVLEWKRPRTDQQNRFLWGVCYPAILEGGGETLAGWTRDDIHEYFLGECFGWETLEGFGRKRMRPIKRSSKLNKQEFSDYLLFLETRCADMGIVIPEPVYAA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.