NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181382_1000870

Scaffold Ga0181382_1000870


Overview

Basic Information
Taxon OID3300017756 Open in IMG/M
Scaffold IDGa0181382_1000870 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15301
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (53.85%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094546Metagenome106N
F103055Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0181382_10008701F103055N/AKLSAVASTVVQHLVRLSRHASTQPVHEGVTMKVFTQVGQKDLDQVKPENINDNTRQVVGEYNGKLDGQNFPVATVDKLKMAPPTLTSTSTANVNGFSHVGQTQDYHRVRRWRVLDNGTDIHTPLINFDLQTNSWSSGWNNLTEIDSTFNDFVLEFEAESGTLSGCFDVNFRHGVDRIQSGVSPNPIVSWSINWWARWGLFCNDVLIAETGRIYPRLLNVSIPFKIFVGSQPVRLELKWQAIDTTAEQEYSVTTHKSSMEIYGASIWACNTKR
Ga0181382_100087011F094546AGGAGMNSDLLALTPELVLFIKKLVQHSRGGLTKDERQELAADLINLLYKVLKELVDTEVEER
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.