NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181385_1001575

Scaffold Ga0181385_1001575


Overview

Basic Information
Taxon OID3300017764 Open in IMG/M
Scaffold IDGa0181385_1001575 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8121
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (38.10%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008239Metagenome / Metatranscriptome336Y
F010650Metagenome / Metatranscriptome301Y
F016811Metagenome / Metatranscriptome244Y

Sequences

Protein IDFamilyRBSSequence
Ga0181385_100157511F016811N/AMEQEQQSEEGQMIYDVGVRLAWKIKRGNGYTNMYKGDKSHPFQFVTRAKSIEHINRSPEMIAKLMSFNGLTGKRIYDFYIQEEFYRKEINRSFTHKEKDYVREYGE
Ga0181385_10015756F010650N/AMKQFLRIANARLRKVYPNGTQRKAWVAKMWANFVERKNIEKDI
Ga0181385_10015759F008239N/AMNREILLEMYEKLWNADKDKWAWNVILKDTLEKLEQK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.