NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181343_1001665

Scaffold Ga0181343_1001665


Overview

Basic Information
Taxon OID3300017766 Open in IMG/M
Scaffold IDGa0181343_1001665 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8790
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.2382Long. (o)-86.2805Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021754Metagenome / Metatranscriptome217Y
F047012Metagenome / Metatranscriptome150Y
F081259Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0181343_100166512F047012AGGAGMKRLLLFVMAVLMVLPVYSAEPYRLPFVELQNGPTKIPFVKDEWTLAVERADWFLFVEKGLLKERKDMYEFHAVTIYKKPYYSQAVKTEVSKIYTYGVLNCKEANLYILYEWYVDPDDTIVFKGSHEYGAYTVEMLTPTTARNDVYNQICKETI
Ga0181343_100166518F021754GGAGMKQSKDYTDFKVQKEILLDYLQVMIAIEDWHGVSDLANDLRELEAKQDNNYKSK
Ga0181343_10016658F081259AGGAGGMLKQFIDWFTKSQMSEIEEYISSHNPKSTADVEQLINEFNYKRKLQCF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.