NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181355_1041262

Scaffold Ga0181355_1041262


Overview

Basic Information
Taxon OID3300017785 Open in IMG/M
Scaffold IDGa0181355_1041262 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1977
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.1881Long. (o)-86.344Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016365Metagenome / Metatranscriptome247Y
F080943Metagenome / Metatranscriptome114N
F083781Metagenome / Metatranscriptome112N

Sequences

Protein IDFamilyRBSSequence
Ga0181355_10412623F016365AGAAGGMNDLIKITLTTGAIVYGMTAPLPANEAVKETQDAINKWYETASTSISQDVTALGVTVSNMPEKISLGVSNFVDETVAFQKESWAKTLTFEQEKQNWETIKGWFTPATEGEKK
Ga0181355_10412626F083781GGAGGMININREKFEKEILDLAKKGNGNSPSFTGGSLYAEMIDQDHAELLRADLEDFTNTNWGDGTKTSPYSTAVKMYKLADQNGRTEFVYDFVPSATAEDLPPEVDMMLCLEAEIARGK
Ga0181355_10412627F080943N/AELEGQRITLEDELERLAYTNNFARIAELEGELFDVKDSIKKITSGHWFEDISRAELLKEEATLQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.