NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181355_1308200

Scaffold Ga0181355_1308200


Overview

Basic Information
Taxon OID3300017785 Open in IMG/M
Scaffold IDGa0181355_1308200 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)592
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.1881Long. (o)-86.344Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001460Metagenome / Metatranscriptome690Y
F037727Metagenome / Metatranscriptome167Y
F049617Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0181355_13082002F001460GAGGMLGYTESDLNKMINAVHDSKLFYLRTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFDNAQ
Ga0181355_13082003F037727AGAAGGMHKSSKFLEYIKLHRISLIQDNENLIQDTNAPDWNFLQGQIIATEHLLSVATDIMNDDER
Ga0181355_13082004F049617GAGGMNSEDIGLPPHLQRLVNAGVSGLDIMHGELKNLMLMAEQELADAIEREEESEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.