Scaffold Ga0169931_10018821

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0169931_10018821

Scaffold Ga0169931_10018821

Overview

Basic Information
Taxon OID	3300017788 Open in IMG/M
Scaffold ID	Ga0169931_10018821 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8947
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Rwanda: Western Province
Coordinates	Lat. (^o)	-1.78	Long. (^o)	29.2	Alt. (m)		Depth (m)	15
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015703	Metagenome / Metatranscriptome	252	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0169931_100188214	F015703	GAG	MIWLLVTRVRQYSNGFLNSLDEQLFEIKFDQYRNGRMVVEVQQNPGRKGWKPSGLMTTKAKWWIYVFSPEAFVAVEVDRLKRYFEVNNKIELKEFVPYSNNPTKGYLLYPEDVNKLLSSDLYDMVPDK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.