NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181565_10024614

Scaffold Ga0181565_10024614


Overview

Basic Information
Taxon OID3300017818 Open in IMG/M
Scaffold IDGa0181565_10024614 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4450
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (61.11%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001971Metagenome / Metatranscriptome609Y
F002907Metagenome / Metatranscriptome521Y
F035678Metagenome / Metatranscriptome171Y

Sequences

Protein IDFamilyRBSSequence
Ga0181565_1002461412F035678GGAGMSEDRKYSRYRIDELAKELGGKWYHKVITNGRQEHKQIVIEYDHKKTT
Ga0181565_1002461417F002907GGAGGVKINPYSIFMKWGVDEPTPLEILSEKVKQLEDRVSVLEDENREQTNSMYECLNSIEARIDILTTERFNDFNLGNK
Ga0181565_100246142F001971N/AMTYEDFINKGTDHYMDMVRLIDIKMKYRMELTTEEKNINEHILEFQQQVKLNELRDRFEKCLEVDE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.