NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181565_10185750

Scaffold Ga0181565_10185750


Overview

Basic Information
Taxon OID3300017818 Open in IMG/M
Scaffold IDGa0181565_10185750 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1436
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000302Metagenome / Metatranscriptome1337Y
F003357Metagenome / Metatranscriptome492N
F029115Metagenome / Metatranscriptome189N
F034715Metagenome / Metatranscriptome174Y

Sequences

Protein IDFamilyRBSSequence
Ga0181565_101857501F034715N/AHGPMMDNDTHCSRCGAKHSSHHEEEMTGWEDEDIESEVEEIW
Ga0181565_101857503F000302AGGAGMINTMTQDTKDRIAELERQKIDLENQLELLGYSGNLVRMHQIEEEIYEIQDTIRKLLP
Ga0181565_101857504F029115AGGAGMDTQIEKKIIDFTRLTGLAERITMSHGTLYVTLHQPEQCDHFHKVIRTFFVDNISNDGGVNMYAVGDEFAFDFVPADREAPVFAEPYSDEKYSGKEIMDNTEMGIWSEFAEDELMNNIPQDVDTMLDLENDAKEGR
Ga0181565_101857505F003357AGGAGGMTRNSWILKQIYTDAKNNLGWVFKVILMAGGFIAGIKLLMFFSVPKEIVFPVLWTAFILVAIYHWYSMKYDWKKDESKYDRASKRYMKKLKGGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.