NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181565_10257683

Scaffold Ga0181565_10257683


Overview

Basic Information
Taxon OID3300017818 Open in IMG/M
Scaffold IDGa0181565_10257683 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1182
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001319Metagenome / Metatranscriptome723Y
F013703Metagenome / Metatranscriptome269Y
F050304Metagenome / Metatranscriptome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0181565_102576831F050304GAGGMRFKKYYKDILSIVGAVLLLGTTILINKYDVKQLYREFATLSLKVNAQEKEIKSLEDRVNVLVVQNQRLLKDLDKHNETRGSENVLLLERLYDLEQKVEILSSKPLSSYISGNDRFEFTDKQVNRIGQYETKGQVLV
Ga0181565_102576832F001319AGGAGMKKIWIMALLIGLVQAQLPQPTMVGQDKLQTPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVDFDSDFELTARVVYLGRPRKSATILGLFRTESTTTEVRVVVELLNRKTGKIVTGNGIGTIDKVISSTGFQINDDLPFDRSELGGALKEAIGNAVQEIL
Ga0181565_102576833F013703N/AYPIEFNKNTLNLQSFVSYTIFRYYEGLKTDTKYLLLESPILIYPGLNIDFNLTRTFKINLGFYVGYNTLVNDLGERNISYSLVFGTNF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.