NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187818_10000069

Scaffold Ga0187818_10000069


Overview

Basic Information
Taxon OID3300017823 Open in IMG/M
Scaffold IDGa0187818_10000069 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)27658
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)23 (71.88%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9061Long. (o)-76.1569Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000321Metagenome / Metatranscriptome1304Y
F001966Metagenome / Metatranscriptome610Y
F013823Metagenome / Metatranscriptome268Y
F022721Metagenome / Metatranscriptome213Y

Sequences

Protein IDFamilyRBSSequence
Ga0187818_1000006918F000321GGAMGELSTSINDALLAVDLNTVELVTLQSRQKQTGRETQVVILNRLRKRIHDVAKKRNCSMNQLVNSALLVFYSKGGESKVKKPAKGRGSSVHSYDTMSEAERRELHEMLAELSAVQSVPFEAEEPNGSYYEYDRNLKATVKVTPDGERTPVEKLETGFEPTRGKGPRKIAHEEITT
Ga0187818_1000006928F013823AGGAMENRKQRSGIESAHDTSAFSCGLFVTVAAMLLGAALSLLPGMGMSQMAFPGAERLALAVMVLGFSGVLVTTLLNLPDITRRTLVVLFAAALLCSGFVALVVWFAVSGASGRWL
Ga0187818_100000693F022721GGGGGMAAYDEMSEAERQQLSKVLASLTGLQGGPTESLPDGTHYEYDPTLKATVEVTPTGDRYPVTLVDGRLIRASERAVAHKTGE
Ga0187818_100000695F001966AGGMEKPDPYGEWVLFGTKQGAGEKPLPVDEELLAAAREAWPHVLAHARRELIDKESGSDRTALAADVWERVLRSVAKTRQRSRDYQPPISDLQSYLIGAFHHRFNRLQKSEHKRQETIELVASTVDLELIEGALDTEWAAELERAITLKQITNRMDGWTKKVWQARQYGYSWKDISRWLGVSEEQARKKFEYNLEKLRESIVRLLKRKNLRPVV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.