NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187818_10028691

Scaffold Ga0187818_10028691


Overview

Basic Information
Taxon OID3300017823 Open in IMG/M
Scaffold IDGa0187818_10028691 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2386
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9061Long. (o)-76.1569Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000042Metagenome / Metatranscriptome3762Y
F001083Metagenome / Metatranscriptome783Y
F026982Metagenome / Metatranscriptome196Y

Sequences

Protein IDFamilyRBSSequence
Ga0187818_100286911F026982N/AKRFLGVPYVTVSAHSRHMQQSCYLDSPEARKTSQHNAEWATG
Ga0187818_100286913F001083GGAGMYTNERQLAISLLEGIREDLTYARLNNGNRILDVADLRQYIYEQIARIRTNAYFEGALYGNIDGKEQDISKGNGHNGKAPI
Ga0187818_100286915F000042AGGAGMTNIKFVVRVSRGGTSAPAYVQRIDRTPVQMTTNRKLALMMGKITAEDAVKSIQNSQCVPELVPVQVSA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.