NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181858_1002047

Scaffold Ga0181858_1002047


Overview

Basic Information
Taxon OID3300017832 Open in IMG/M
Scaffold IDGa0181858_1002047 Open in IMG/M
Source Dataset NameFeedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_SG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)9697
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Feedstock Adapted Compost Microbial Communities From Newby Island Compost Facility, Milpitas Ca

Source Dataset Sampling Location
Location NameNewby Island compost facility, Milpitas, CA
CoordinatesLat. (o)37.454581Long. (o)-121.928712Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036417Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0181858_10020476F036417N/AMVYYARVPIRQLIPTVLVRLATDEGEVVFRARWNRSPLELQRSILFRLRQGTHLWFETEWGHSICFKPESVWGAVVDGR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.