NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187856_1001078

Scaffold Ga0187856_1001078


Overview

Basic Information
Taxon OID3300017925 Open in IMG/M
Scaffold IDGa0187856_1001078 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22484
Total Scaffold Genes27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (70.37%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013914Metagenome / Metatranscriptome267Y
F016557Metagenome / Metatranscriptome246Y
F082985Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0187856_100107814F016557N/AMAKFKSAGTKKTSQKVKSARAALPCLVLVALGIALMCLLFYFSLQSNTNPQ
Ga0187856_10010786F013914GGAGGVANQALDEEKTLARLQTLMRSEHWLATYVSDLLSAHDLSAGIDFRTAEQLLAAEKEQFEKDLAIARRMLRVYGKQVMAENMSQNAYAPNG
Ga0187856_10010787F082985GAGGMYIDTRELNDLTRRATELMSETADVPRVLRNQLGEHHELAIAAEAMQGSIESFVRELRCFDVSAQTVGADTFEGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.