NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187856_1050124

Scaffold Ga0187856_1050124


Overview

Basic Information
Taxon OID3300017925 Open in IMG/M
Scaffold IDGa0187856_1050124 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1835
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004185Metagenome / Metatranscriptome449Y
F006683Metagenome / Metatranscriptome367Y
F015081Metagenome257Y

Sequences

Protein IDFamilyRBSSequence
Ga0187856_10501241F004185AGGAGGMSLKKEFIRDGNRRIIGSTTTGYVGSFETIVRDEQNNITGSTSERFNTTRDEHDSLISIN
Ga0187856_10501242F015081AGGVPDYSGGEEISVEGLIEEQRKLAHSTNPFERVLGSLRISAILKNQLMGLPNSTIGRLMTDHVWSELNLLGPESVIVEIASERLIEKYETSLVCPECGAELRRAYE
Ga0187856_10501243F006683GGAGGMNKPDRADVRQVHLRVNGIAFESVRVRHDLGANDFDIVIDDPHVGRFALTAAVPHLELRDEDFDWRQVTLDELKKILANDGELAEVAQEPQASEAAKRESFNRRVAEGEHIMNAEIALFRAGIPFLQLPFQQNKFSSNLFMVLNVPKAKACLQRVGFQAKFDSETVLFDGSNGQPIQLIQGSYRLPRAKS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.