Basic Information | |
---|---|
Taxon OID | 3300017928 Open in IMG/M |
Scaffold ID | Ga0187806_1232498 Open in IMG/M |
Source Dataset Name | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 633 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion. |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: North Carolina | |||||||
Coordinates | Lat. (o) | 35.9061 | Long. (o) | -76.1569 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F017180 | Metagenome / Metatranscriptome | 242 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0187806_12324982 | F017180 | GGA | MSFTAATQQIPAVDQPKHPLHALTTYELTYYRRRLENAIAFLDKQDPVPPIRGDLQAALDGVLAEQDDRARIAAADA |
⦗Top⦘ |