NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187814_10064456

Scaffold Ga0187814_10064456


Overview

Basic Information
Taxon OID3300017932 Open in IMG/M
Scaffold IDGa0187814_10064456 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1344
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9061Long. (o)-76.1569Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005268Metagenome / Metatranscriptome406Y
F058360Metagenome / Metatranscriptome135Y
F072127Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0187814_100644562F005268AGGAVSKSDEETEQQQVWRTLSEAGLVEIRLDEFAERIRDVKRIVIVRLRELLDVNNSVKERESAACSLGTLKGLELKVLASQLPDPSEM
Ga0187814_100644563F072127GGAGMLKEVRWGLVWRDCILEDGRVIPEHRVSGCPRPQAWRKISEVTDREREECEERLLLMAGAGMDPRKRDQSFWAELNQYLAYTYLRYKRAGSEAHVTEG
Ga0187814_100644564F058360N/APKLLPRVIPMPASPRGMVLAASVAVPDPDAGFMLRVEQAVDRVLSRSDWPRPMTNGPQIVSRKPNPEEGN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.