NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187803_10226705

Scaffold Ga0187803_10226705


Overview

Basic Information
Taxon OID3300017934 Open in IMG/M
Scaffold IDGa0187803_10226705 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)738
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9061Long. (o)-76.1569Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023986Metagenome / Metatranscriptome208Y
F055024Metagenome / Metatranscriptome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0187803_102267051F023986AGGAGMFPQKWTLVGCAILLAPGCALAREDKDQQAYCAYVMEQAQAQRDLLRTPTADAGMTQPETGLPVQIVGGASLGLSDLKKAGLTMEVARKNCELYKATIETQQEIQYTLPSLEMEALRHRLTLIERASKSLDGLMEKTAQMVQAQNATRIMIFSLQTTKIKLSADRADTQAKIAAIYVPPLSGRPLKELVARKQSGEAEV
Ga0187803_102267052F055024N/AEETAIHPIFKTNIRGFLIQMDLQQPDSAKSKTVFLGRRPLLF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.