NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187819_10080530

Scaffold Ga0187819_10080530


Overview

Basic Information
Taxon OID3300017943 Open in IMG/M
Scaffold IDGa0187819_10080530 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1943
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter methanicus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9061Long. (o)-76.1569Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005680Metagenome / Metatranscriptome393Y
F010361Metagenome / Metatranscriptome305Y
F010498Metagenome / Metatranscriptome303Y

Sequences

Protein IDFamilyRBSSequence
Ga0187819_100805303F010498GGAGGMRHEYTDKHQKKVFEDVLTERRYQDRQWGHGIDDTKNTPWMWMAYVCSYATKWMKDPFRFKREDTNEFYDRMIETAAIAAAACESILRQRDMNGKTFYEPN
Ga0187819_100805305F010361AGGAGGMGTLVFVCPTTGHEVSIGVEVDRSSFKSLPRTKTAIFCPRCRKNHKLSVIWAWLANEIREAPDESPCTKPAASMVCP
Ga0187819_100805306F005680N/AGLADIRLEVRGGDIIVDLPGTNYTVTYHKPGVSPQLLANYLPVKDDPRTELTQAEFLARAWRLANDKALELDWIA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.