NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187879_10001548

Scaffold Ga0187879_10001548


Overview

Basic Information
Taxon OID3300017946 Open in IMG/M
Scaffold IDGa0187879_10001548 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15740
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (87.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010557Metagenome / Metatranscriptome302Y
F028251Metagenome / Metatranscriptome192Y

Sequences

Protein IDFamilyRBSSequence
Ga0187879_100015483F028251AGGAGGVKQMVDPSGIQYAVIEGLRTETGPERLVIAYPDEKSLRELIAAASIIAVGFSSREEAVAGGRASVPAGIYRQQMRETIAAGGTFGHRRRLSWAERPGEIGSTVQRLGRFLVTSYSNAATAVIAIFLSRNAVSAVIRMALGSFA
Ga0187879_100015484F010557AGGAGMNEDRTNLNTALERYLKSGRQFGEGEKFYLLGFEAALHARNRCKELDQIASEMTSDLEELQQQYPRVAVEEPFTSGFQQGREYYQRLCDESNPA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.