NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187879_10008059

Scaffold Ga0187879_10008059


Overview

Basic Information
Taxon OID3300017946 Open in IMG/M
Scaffold IDGa0187879_10008059 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6863
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000174Metagenome / Metatranscriptome1764Y
F004611Metagenome / Metatranscriptome431Y
F040446Metagenome / Metatranscriptome161Y

Sequences

Protein IDFamilyRBSSequence
Ga0187879_100080591F040446GGAGGMQHGANGSNGAGNGTLLHTGDPHVQEVVKTAHEELRQLMRQRAEIMKRIGTLKQTISGLANLFGDEILGEDLLELVDRKTGGRQPGFTKACRMVLMEAGRPLAVRE
Ga0187879_100080594F000174AGAAGGMKNVYEVLRQKELELARLEKEVEALRVAAPLLSDDKESMLEATSNKPTLASPTTAQQPIRIPQAAVNASPQPARAAGWEDTAKRWP
Ga0187879_100080596F004611AGGAVADSRSYSRRWTVIASALLCCGLGVVVLYTRRSAFFSPLAVVVVAAIGLAAVLLQLRFYNRGHSNPVHAPAWLNILGVGFALAAFFADFLGLSWQMAEVVALGAVGSFAISSAMILHAFRKNRTMPK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.