NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187817_10229937

Scaffold Ga0187817_10229937


Overview

Basic Information
Taxon OID3300017955 Open in IMG/M
Scaffold IDGa0187817_10229937 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1182
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9061Long. (o)-76.1569Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037842Metagenome / Metatranscriptome167N
F044617Metagenome / Metatranscriptome154N
F065986Metagenome127N

Sequences

Protein IDFamilyRBSSequence
Ga0187817_102299371F044617AGGAMSISPKPSRQTPGVTAITAEERKTLDKRVRDKHQRLRNRYPEIYGKVVDWIHHYIEDGTLYVCIRFQDKTDFALEFNPQIVTVGTELCDS
Ga0187817_102299372F065986GGAMSNIAKRQGRMICKGKEVRFGSVHIDLIGPTELLHNREAKGAAIDFLRTEILASKDWLKDCAKISPSLKRFRLVSIRT
Ga0187817_102299374F037842AGGAMLKQKTVKARGEGLEYPALTGKVIRQVRFVNDEDYTALTIEFDDSTLVSFRFKASIAFSIDPELSTVKGGNIVRWRELKTRPVMRRIARR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.