NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181581_10128049

Scaffold Ga0181581_10128049


Overview

Basic Information
Taxon OID3300017962 Open in IMG/M
Scaffold IDGa0181581_10128049 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1726
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030730Metagenome / Metatranscriptome184Y
F043914Metagenome / Metatranscriptome155Y
F048329Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
Ga0181581_101280491F048329N/AMFIFTEENIGNIKNAVYSTDGMKDKHAKKIEYAKSKGLFKDFNMSKYFDRKPPKNTSLRTYQELMYLKDLPEDLEYVKQHDTIEEVFQE
Ga0181581_101280492F030730N/AMGKFKEKVIEKGSGLVAKSQSKKQLQKVLPKPIAKQVGKKIGKGVESLTSMALDIYNKFK
Ga0181581_101280494F043914AGTAGMKKLWVFLLLILFSCQPDELLVVEPYQQYEMIFEESISKVVDGQEFSFEVLTEGKHELIIADKNGSVITKESFIPIAGLNTRYLYIKTLPKGELQLSLSDSSNVVKSTSIIVD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.