Scaffold Ga0190266_10249366

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0190266_10249366

Scaffold Ga0190266_10249366

Overview

Basic Information
Taxon OID	3300017965 Open in IMG/M
Scaffold ID	Ga0190266_10249366 Open in IMG/M
Source Dataset Name	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	889
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location Name	USA: Utah
Coordinates	Lat. (^o)	37.9013	Long. (^o)	-109.5337	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050186	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190266_102493662	F050186	N/A	MANVEEVAQRLLKALNEHQGHDREGATVEPGDQEAGGAGLRMGSPLYRAAIWWLLDVGALIPDEEANKQRRNTVGAQHRGFMFKITPHGLDMLRET

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.