Scaffold Ga0180438_10086897

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0180438_10086897

Scaffold Ga0180438_10086897

Overview

Basic Information
Taxon OID	3300017971 Open in IMG/M
Scaffold ID	Ga0180438_10086897 Open in IMG/M
Source Dataset Name	Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2737
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (57.14%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum → Candidatus Puniceispirillum marinum IMCC1322	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	33.3	Long. (^o)	-115.8	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092918	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0180438_100868973	F092918	N/A	MKQKSKSPILKSIMSEIDEQLASIPLHEADGTPIEDSMHLDMYIDGVANISFTDDINRKHYPVNKTLATILVFDEIETRKNEPTKEDMHG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.