NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180438_10729119

Scaffold Ga0180438_10729119


Overview

Basic Information
Taxon OID3300017971 Open in IMG/M
Scaffold IDGa0180438_10729119 Open in IMG/M
Source Dataset NameHypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)727
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.3Long. (o)-115.8Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056176Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0180438_107291191F056176N/ANNTFILAKALVPLSIKLYEGRNILKLVNREPVSPIAKSWTTIQEHLVNVT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.