NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187781_10078892

Scaffold Ga0187781_10078892


Overview

Basic Information
Taxon OID3300017972 Open in IMG/M
Scaffold IDGa0187781_10078892 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2274
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Pseudosporangium → Pseudosporangium ferrugineum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)4.0627Long. (o)-73.195Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028561Metagenome / Metatranscriptome191Y
F033467Metagenome / Metatranscriptome177Y

Sequences

Protein IDFamilyRBSSequence
Ga0187781_100788921F028561GGAGGVNNPHRDAGAPAFTASQDPACDDAGLLHRIGQGDEDAMAAFYREHGRVVF
Ga0187781_100788924F033467AGGAGGMMFHPTIAQQLAAERQREILDHASRRRQARTAQATQPARPATADQTRPYLLRRARAALTS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.