NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187781_10296616

Scaffold Ga0187781_10296616


Overview

Basic Information
Taxon OID3300017972 Open in IMG/M
Scaffold IDGa0187781_10296616 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1147
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)4.0627Long. (o)-73.195Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005107Metagenome / Metatranscriptome412Y
F014059Metagenome / Metatranscriptome266Y

Sequences

Protein IDFamilyRBSSequence
Ga0187781_102966161F005107GGTGGVVTDHTSVGVRVALDAGFQAVRTRLSTLAEAGMLSQACEVAYGEGITGLVDFAGPAAGLTRLADVWLEDLTETGDCAHIALQWNAIAADGKLFTALLADLMLTPAGDQSTILSLTGTYWPPPGLADPEPGQAIMRRCATAAMGSFLDSVACELVHPAGTG
Ga0187781_102966162F014059AGGVAATSSWPVVLRGGVVVEDPLSVVLGLLARWRLDLGAPAQPLSFGEPDLRLANRGGARISAAEIAAILERRGAIEQALGAIAPAASLSGQAGSVPWLRNTW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.