NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187782_10000519

Scaffold Ga0187782_10000519


Overview

Basic Information
Taxon OID3300017975 Open in IMG/M
Scaffold IDGa0187782_10000519 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)26199
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (77.27%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)4.0627Long. (o)-73.195Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001450Metagenome / Metatranscriptome692Y
F008315Metagenome / Metatranscriptome335Y
F060173Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0187782_1000051917F060173GAGMTGRRYYLTTYGDWLRHSARFANSHWLSLSEQRNESSPILVLIEADEGVHLVLEDDKAFKALPHPLTQKPISEAAQIALAGQGIAQGATTFEVAESLGSKHPLLRYRVF
Ga0187782_1000051920F008315N/AMRKFLDPYWWRFALALLVQFVVFIRWIYRRIRDDELNRAFIRDMATNHLPRIYELLEKLCGQQGIEQSPRPPIRWVDLRGRRNVPH
Ga0187782_100005198F001450GAGMQISWGSLLVNEIRLIRVIRETHEAPAAVQERIARAGGSNRYGEPNFRVVWGAARLAWIGGRWTDRDANGHVIRETVELRRAPKYVPQNRWHVERWMPPEMYGSPEEWYEQTIEVEDGIQVAALGPYPTRGEYEHCFTLESADREFIPLSAAACDWIASAVEWARRQARGRRLGALNAREAVRERNWDRMADEVLNGDFDM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.