NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181520_10006715

Scaffold Ga0181520_10006715


Overview

Basic Information
Taxon OID3300017988 Open in IMG/M
Scaffold IDGa0181520_10006715 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17418
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (90.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).3 to .4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008704Metagenome / Metatranscriptome329Y
F017104Metagenome / Metatranscriptome242Y
F052336Metagenome / Metatranscriptome142Y

Sequences

Protein IDFamilyRBSSequence
Ga0181520_1000671517F017104GGAGGMSQYQKIKEATADVVGVRIARKRSTKRAHEAIRDLIVASPALSYQRLAEMLGCSRWLVSRVAVEFNVRRPRGAGAPAHKEEQ
Ga0181520_100067152F008704GGAGGMDYFHVFVLTSLDLDKSGDVKSRNVAVTFDLFEAEDHRNKGVENDYDVFVVPGDWQEDAARSELISAMRGFRSIVKQMENEALR
Ga0181520_100067155F052336GGAGVTIRELIDEQRRRLGPGKPVERFAAAMLIPAVLAERLAGLADRQVGQLLLDEVWPGLSPLAPESTICLHAADRLRGQMKQSPTCPKCDSEMIRHIGIDEPDSLKCALLNCGLRIQET

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.