NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180434_10341150

Scaffold Ga0180434_10341150


Overview

Basic Information
Taxon OID3300017991 Open in IMG/M
Scaffold IDGa0180434_10341150 Open in IMG/M
Source Dataset NameHypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1169
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.4166Long. (o)-115.9166Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015342Metagenome / Metatranscriptome255Y
F025285Metagenome / Metatranscriptome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0180434_103411501F015342N/AMSVAANMPARNVKGNVQAQDKILYVANKLGLSSLKYMQATTRVVYDQSVTAATQHTLFEGAAARSFPLTNLGANGNQFQVDEALLVEKIAFFIPDADDGENFNAASGLSFKFDLIIGNKTVMKDVVVELGGQQAFYNDGSAGSNCLELEGVGILIPPQVEFKMTVKPLTTSARVASSQRVGCYLFGTGVLLNFNTSI
Ga0180434_103411502F025285N/AMSQVSKLNMVNAKLGATMPGQQTTRYIYDTVIAGAVGNTQFDFFQTFAGKTDLQTNLTTNKLDSSESMVIKSIYVAIDAGGGTLNLAGHSNLNITVGNQVVLKDFNIAFNASNRGVSYDRLHSGFNATTIVEVRLLTDIVIPPQVNFKASLQMAEATAGADTSITLGFKGYGTIFSAGST
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.