NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187767_10388040

Scaffold Ga0187767_10388040


Overview

Basic Information
Taxon OID3300017999 Open in IMG/M
Scaffold IDGa0187767_10388040 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)501
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)3.8381Long. (o)-73.3194Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048856Metagenome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0187767_103880402F048856GGGGGMHVLLDDDEGCLTLRRIGPWTRMLARVLGARLDRELADGTSPEANASLAARAMWLTSMEFRRGLAASLQQMLAATGEQARVPSPAASSSLGATRPPRVP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.