NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187865_1000195

Scaffold Ga0187865_1000195


Overview

Basic Information
Taxon OID3300018004 Open in IMG/M
Scaffold IDGa0187865_1000195 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)88704
Total Scaffold Genes78 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)64 (82.05%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013445Metagenome / Metatranscriptome271Y
F029881Metagenome / Metatranscriptome187Y
F068890Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0187865_100019515F029881GAGGMPILMMALLALVVFGLIGILLTTAMILEHKTHAHAAKGDAARPGTSGAVSSLHPKI
Ga0187865_100019570F013445N/AMLNIVDYTWYCVKWKMICEVWMKVLESPQLMTAKDERIGFRVSSEIKVALLQIAKKEGRSLGQVCELLLRGGIHEYEREGSRYLHRSLERPKEKGK
Ga0187865_100019571F068890AGGAGMFACILVFEVKLAKKEEFVKVVRDQVLPILKKQIGFLEILPFFPEKMKAGKVIAITLWTTRRDAERYEREFYPKVLDIMKPFLTAPVEVNYSNLETTLCDRFVDALAV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.