NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187884_10046065

Scaffold Ga0187884_10046065


Overview

Basic Information
Taxon OID3300018009 Open in IMG/M
Scaffold IDGa0187884_10046065 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2063
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001528Metagenome / Metatranscriptome677Y
F004392Metagenome / Metatranscriptome440N
F082398Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
Ga0187884_100460651F082398N/AVIVLYASLSGLLRHAGLSEGTVGILPLVLFAAGILLKPRAVQFIERRRKDRTTGTHDGRAHVDAGEKQEIARKETDERCQ
Ga0187884_100460652F004392GGAMPVNGPETIADLKTPQPVAPEGRSVLAAKDAKPAVARGAATRRRRDQQESSKTNGEERFFLASANRNGDVPTLGRECATEAEAIIEAFREKVNLYRVTEFQTRADIGRSGEPILRKETLKKNNPAS
Ga0187884_100460653F001528AGGAGMSEKNQIVVVLIVALFLGAFVDRITALKIVAGVVLLWTLQNQPVVFECIRKLFSFVQRRPSVREYRGGVTTVRAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.