NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187880_1024365

Scaffold Ga0187880_1024365


Overview

Basic Information
Taxon OID3300018016 Open in IMG/M
Scaffold IDGa0187880_1024365 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3554
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003186Metagenome / Metatranscriptome502N
F015314Metagenome / Metatranscriptome255N
F027718Metagenome / Metatranscriptome193N

Sequences

Protein IDFamilyRBSSequence
Ga0187880_10243651F003186N/AVINPKTILGEWVTALQSCPDLVTAIGGDGDNIRAFMEGLANDNNLRLAILQMPPGSILIAWNGTTPRRLTGGALHFAHRFAIYLRAPEQESTATYADLFWLLVSARPTGAPSWESLLHLQIDPDCYPMDMDLPSAQRNTVVVSADGATLDYFEVQATLVEQGNPGGE
Ga0187880_10243655F015314GGCGGMMLRRESWARLTRGGVPPLYVLRPLQGFTPSDIGDEYPAPAATNKVQLMRARQLYEQRRIGTQPEAERTLSKLPQHEPAKPGKEKRFQSGKNAR
Ga0187880_10243658F027718N/AGQYFSVAEISEELTAARVMESERSMITSHVNPNQGAVGSLQEIEAQATSYARQNRGKETPNLYAESGTTKLTKERAYAQMLEEHPEVYGAFVAQHNAKGLIATLERAGVRLAR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.