NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187851_10143800

Scaffold Ga0187851_10143800


Overview

Basic Information
Taxon OID3300018046 Open in IMG/M
Scaffold IDGa0187851_10143800 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1448
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093144Metagenome / Metatranscriptome106Y
F102352Metagenome101Y
F104279Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0187851_101438001F104279N/AMAKAINLYHLGGVIGLSLGAAELVAAFSANSLMRRKTKP
Ga0187851_101438002F093144AGGAGMTMKNISITTVMLITLSLPLAQAGVGMPGTITVADLARETAAKKTLTRAQVSAGAVADEADQLRRGANSMFSQDSHRDKLTALKGKVNRMGQEINSLRAERESLAPWEQQAIDEILPLLRATAENTESAIEYFNEHGDRLWMGTYRDYADHIWWGSDQIAKILKNYLKYDRLRDQEVYAEERLRAASQRFDEQSQWGGQ
Ga0187851_101438004F102352AGGAGGMKKFLFAILALFALAVWMTLVQAKETSKPPNFSGNWVLNFGQTKNRPDGLQGYELVAKQDEQQLKVETTLEGDLQGT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.