NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187766_10075481

Scaffold Ga0187766_10075481


Overview

Basic Information
Taxon OID3300018058 Open in IMG/M
Scaffold IDGa0187766_10075481 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2013
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)3.8381Long. (o)-73.3194Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031805Metagenome181Y
F035065Metagenome / Metatranscriptome173Y

Sequences

Protein IDFamilyRBSSequence
Ga0187766_100754812F035065AGGAMTDREVDALSDFLQHFGVFQCRGISVRRSAPKPRTEEELGRLVLDTLARWRAEGLDAERLYKIATIVLHFDVCSLPGGMCMPACCRPWGELAATCPPRPGGPRTGAQLQQALLRAIPIGPAPAPDAPLPDDLDEDLKRTGLLPWEPGSERP
Ga0187766_100754814F031805N/AVVAPAIERLQDWGTWLHCAQDMSIVQLQAKVSEALDALPRGREPAPPGEHFRRTVLAAMPDIEAMELVEHFFTLGKRVVGSPNPIAIFLAGCRECLPEWEVQAAGPRLTPSPASDPRVCPTGQNSP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.