Scaffold Ga0180430_10199242

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0180430_10199242

Scaffold Ga0180430_10199242

Overview

Basic Information
Taxon OID	3300018065 Open in IMG/M
Scaffold ID	Ga0180430_10199242 Open in IMG/M
Source Dataset Name	Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1358
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	33.4166	Long. (^o)	-115.9166	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090093	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0180430_101992422	F090093	GAGG	MSLRTIAAIACVYVAVFGLPNIQLPSISPSAPERPDVDKPSAALQEAVADVAAICERMSTFDRLVWMSTWEDCSAIVAGEDEDVSVTFDNTLALRLFTDSTFQVAWNRLANASGKYRGLGEAVEKAFANVIGNEVRPWSAEVADDVIDLYDALAWAGARSD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.