NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184617_1106862

Scaffold Ga0184617_1106862


Overview

Basic Information
Taxon OID3300018066 Open in IMG/M
Scaffold IDGa0184617_1106862 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)788
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026500Metagenome197Y
F031020Metagenome / Metatranscriptome183Y

Sequences

Protein IDFamilyRBSSequence
Ga0184617_11068621F026500GGAGMTEDFGGGDVRYEGDRPVAVGDLRLAQPTRMATTSAGFWGLYEAGNEVLVVHPAGARRGPAAELGAWLAAIAADDGRDDADRETARSFLPFLGGDDPGAAADVPRSRVEQGPPPTYDLSDERNTP
Ga0184617_11068622F031020N/AGPKAVMTAYAQALEAGDAGLAADLYAENGLLTSADEQISGRAGIAGWHEDLLRRGRVTATQAGQGNDAGRLEVDSAAGHHVVELALDASGRIGTARWLTPDEANLPQEERERSAT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.