NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184635_10152962

Scaffold Ga0184635_10152962


Overview

Basic Information
Taxon OID3300018072 Open in IMG/M
Scaffold IDGa0184635_10152962 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)921
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068537Metagenome / Metatranscriptome124Y
F085292Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0184635_101529621F068537AGGAGMKINYPTVAVLSVLVLFAGLILTQPALAQAAQEKAQIAEGTLVKVDAAAKTLSVKTSKGEMEFRYTDATQISGADGVEGLATQSGAPVKVHFDAASKTASKIEVGQRK
Ga0184635_101529622F085292AGGAGGMRTEKQVSILGVVTLFVLVMTGCSETQKQTSAEKTQPDQAEKAAPMAQAQETPQIFDGELLKVDATAKTLSVKNSEGQEIEFRYNDQTLISGANGGVEGLATKSGTPVSVHFDTATRTAAKIEVRQR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.