NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190272_10912883

Scaffold Ga0190272_10912883


Overview

Basic Information
Taxon OID3300018429 Open in IMG/M
Scaffold IDGa0190272_10912883 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)826
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.4668Long. (o)-109.6253Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050617Metagenome / Metatranscriptome145Y
F072590Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0190272_109128831F050617N/ARQTVEGGPSMRIWAWIAIGLVVAALAVLVFPLVQIQTELRLANEQVVQARARIAELERVVANLKTELDAANRARTQLQGGLEEANSEIEKRQSEVERLSAELEKATDLAKDAEAPDQDGDSASKPSDGWQPQ
Ga0190272_109128832F072590AGGAGGMRNFKSVRFAWSKEILNGVVMYKAAKPKSHAFEYTVLVKGKRLNNTSDKSVVMKHRRGDVKILLSVEHSLTRRRDVNDAIRIAGENDIDADIEGRN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.